PDB entry 3pf3

View 3pf3 on RCSB PDB site
Description: Crystal structure of a mutant (C202A) of Triosephosphate isomerase from Giardia lamblia derivatized with MMTS
Class: isomerase
Keywords: triosephosphate isomerase, giardia, isomerase, alpha/beta barrel, thiomethylation, alfa/beta barrel, thiomethylation of cys14, cys222, cys 228
Deposited on 2010-10-27, released 2011-06-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-08-24, with a file datestamp of 2011-08-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.182
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Giardia intestinalis [TaxId:5741]
    Gene: gltim
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36186 (Start-256)
      • engineered mutation (201)
    Domains in SCOPe 2.01: d3pf3a_
  • Heterogens: SO4, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pf3A (A:)
    mparrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskql
    riaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralek
    gmtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvv
    atpeqaeevhvglrkwfaekvaaegaqhiriiyggsangsnceklgqcpnidgflvggas
    lkpefmtmidiltktrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pf3A (A:)
    parrpfiggnfkcngsldfikshvaaiaahkipdsvdvviapsavhlstaiaantskqlr
    iaaqnvylegngawtgetsvemlqdmglkhvivghserrrimgetdeqsakkakralekg
    mtvifcvgetlderkanrtmevniaqlealgkelgeskmlwkevviayepvwsigtgvva
    tpeqaeevhvglrkwfaekvaaegaqhiriiyggsangsnceklgqcpnidgflvggasl
    kpefmtmidiltktrt