PDB entry 3pew

View 3pew on RCSB PDB site
Description: S. cerevisiae Dbp5 L327V bound to RNA and ADP BeF3
Class: hydrolase/RNA
Keywords: RecA, DEAD-box, ATPase, Helicase, mRNA export, Nuclear Pore, HYDROLASE-RNA complex
Deposited on 2010-10-27, released 2011-03-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.166
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DBP5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DBP5, RAT8, YOR046C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20449 (3-End)
      • engineered mutation (239)
    Domains in SCOPe 2.05: d3pewa1, d3pewa2
  • Chain 'B':
    Compound: RNA (5'-r(p*up*up*up*up*up*u)-3')
  • Heterogens: ADP, MG, BEF, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pewA (A:)
    gamaksfdelglapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaa
    fsltmltrvnpedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqi
    naqvivgtpgtvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtql
    vlfsatfadavrqyakkivpnantlelqtnevnvdaikqlymdckneadkfdvltelygv
    mtigssiifvatkktanvlygklkseghevsilhgdlqtqerdrliddfregrskvlitt
    nvlargidiptvsmvvnydlptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfn
    ilsaiqkyfgdiemtrvptddwdevekivkkvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pewA (A:)
    aksfdelglapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaafsl
    tmltrvnpedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqinaq
    vivgtpgtvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtqlvlf
    satfadavrqyakkivpnantlelqtnevnvdaikqlymdckneadkfdvltelygvmti
    gssiifvatkktanvlygklkseghevsilhgdlqtqerdrliddfregrskvlittnvl
    argidiptvsmvvnydlptlangqadpatyihrigrtgrfgrkgvaisfvhdknsfnils
    aiqkyfgdiemtrvptddwdevekivkkvlk
    

  • Chain 'B':
    No sequence available.