PDB entry 3pev

View 3pev on RCSB PDB site
Description: S. cerevisiae Dbp5 L327V C-terminal domain bound to Gle1 and IP6
Class: hydrolase
Keywords: RecA, HEAT, DEAD-box, ATPase, Helicase, mRNA export, Nuclear Pore, HYDROLASE
Deposited on 2010-10-27, released 2011-03-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.204
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DBP5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DBP5, RAT8, YOR046C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20449 (Start-187)
      • engineered mutation (32)
    Domains in SCOPe 2.05: d3peva_
  • Chain 'B':
    Compound: Nucleoporin GLE1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BRR3, D1049, GLE1, RSS1, YDL207W
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, GOL, IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pevA (A:)
    ganevnvdaikqlymdckneadkfdvltelygvmtigssiifvatkktanvlygklkseg
    hevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangq
    adpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevek
    ivkkvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pevA (A:)
    aikqlymdckneadkfdvltelygvmtigssiifvatkktanvlygklkseghevsilhg
    dlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangqadpatyih
    rigrtggrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevekivkkvlkd
    

  • Chain 'B':
    No sequence available.