PDB entry 3peu

View 3peu on RCSB PDB site
Description: S. cerevisiae Dbp5 L327V C-terminal domain bound to Gle1 H337R and IP6
Class: hydrolase
Keywords: RecA, HEAT, DEAD-box, ATPase, Helicase, mRNA export, Nuclear Pore, HYDROLASE
Deposited on 2010-10-27, released 2011-03-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.188
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DBP5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: DBP5, RAT8, YOR046C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20449 (Start-187)
      • expression tag (32)
    Domains in SCOPe 2.04: d3peua_
  • Chain 'B':
    Compound: Nucleoporin GLE1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: BRR3, D1049, GLE1, RSS1, YDL207W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12315 (2-296)
      • engineered mutation (95)
  • Heterogens: SO4, GOL, IHP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3peuA (A:)
ganevnvdaikqlymdckneadkfdvltelygvmtigssiifvatkktanvlygklkseg
hevsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangq
adpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevek
ivkkvlkd

    Sequence, based on observed residues (ATOM records): (download) 
    >3peuA (A:)
aikqlymdckneadkfdvltelygvmtigssiifvatkktanvlygklkseghevsilhg
dlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangqadpatyih
rigrtggrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdevekivkkvlkd

  • Chain 'B':
    No sequence available.