PDB entry 3pep

View 3pep on RCSB PDB site
Description: revised 2.3 angstroms structure of porcine pepsin. evidence for a flexible subdomain
Class: hydrolase (acid proteinase)
Keywords: hydrolase (acid proteinase)
Deposited on 1989-10-24, released 1990-04-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.171
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepsin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00791 (0-325)
      • conflict (262)
    Domains in SCOPe 2.05: d3pepa_
  • Heterogens: EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pepA (A:)
    igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
    sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
    lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
    wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
    sdgemviscssidslpdivftidgvqyplspsayilqdddsctsgfegmdvptssgelwi
    lgdvfirqyytvfdrannkvglapva