PDB entry 3pel

View 3pel on RCSB PDB site
Description: Structure of Greyhound Hemoglobin: Origin of High Oxygen Affinity
Class: oxygen transport
Keywords: Globin fold, Oxygen/CO2 transport, Heme binding, red blood cells, OXYGEN TRANSPORT
Deposited on 2010-10-26, released 2010-11-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pela_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pelb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pelA (A:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkffaavstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pelB (B:)
    vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
    kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
    eftpqvqaayqkvvagvanalahkyh