PDB entry 3pe6

View 3pe6 on RCSB PDB site
Description: Crystal Structure of a soluble form of human MGLL in complex with an inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: alpha-beta hydrolase fold, Lipase, 2-arachidonyl-glycerol, Membrane associated, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-10-25, released 2011-03-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.115
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monoglyceride lipase
    Species: Homo sapiens [TaxId:9606]
    Gene: MGLL, hCG_40840
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6IBG9
      • engineered mutation (35)
      • engineered mutation (168)
      • engineered mutation (175)
    Domains in SCOPe 2.06: d3pe6a_
  • Heterogens: ZYH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pe6A (A:)
    mpeessprrtpqsipyqdlphlvnadgqylfcrywaptgtpkalifvshgagehsgryee
    larmlmgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllg
    hsmggaiailtaaerpghfagmvlisplvlanpesattfkvlaakvlnsvlpnlssgpid
    ssvlsrnktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadr
    lcdskgayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrtatagta
    spp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pe6A (A:)
    prrtpqsipyqdlphlvnadgqylfcrywaptgtpkalifvshgagehsgryeelarmlm
    gldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgga
    iailtaaerpghfagmvlisplvlanpesattfkvlaakvlnsvlpnlssgpidssvlsr
    nktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdskg
    ayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrta