PDB entry 3pdz

View 3pdz on RCSB PDB site
Description: solution structure of the pdz2 domain from human phosphatase hptp1e
Class: hydrolase
Keywords: pdz domain, human phosphatase, hptp1e, ptp-bas, specificity of binding, hydrolase
Deposited on 1999-05-10, released 2000-03-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (tyrosine phosphatase (ptp-bas, type 1))
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q12923 (0-95)
  Domains in SCOPe 2.08: d3pdza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3pdzA (A:)
  pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
  vngvslegathkqavetlrntgqvvhlllekgqspt