PDB entry 3pdx

View 3pdx on RCSB PDB site
Description: Crystal structural of mouse tyrosine aminotransferase
Class: transferase
Keywords: alpha/bata protein, aminotransferase, PLP-binding, TRANSFERASE
Deposited on 2010-10-25, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.265
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine aminotransferase
    Species: Mus musculus [TaxId:10090]
    Gene: TAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pdxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pdxA (A:)
    wnvrpsdmsnktfnpiraivdnmkvkpnpnktvislsigdptvfgnlptdpevtqamkda
    ldsgkyngyapsigylssreevasyyhcpeapleakdviltsgcsqaielclavlanpgq
    niliprpgfslyrtlaesmgievklynllpeksweidlkqleslidektaclvvnnpsnp
    cgsvfskrhlqkilavaerqcvpiladeiygdmvfsdckyepmatlstnvpilscgglak
    rwlvpgwrlgwilihdrrdifgneirdglvklsqrilgpctivqgalksilqrtpqefyq
    dtlsflksnadlcygalsaipglqpvrpsgamylmvgiemehfpefendvefterliaeq
    svhclpatcfeypnffrvvitvpevmmleacsriqefceqhy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdxA (A:)
    kvkpnpnktvislsigdptvfgnlptdpevtqamkdaldsgkyngyapsigylssreeva
    syyhcpeapleakdviltsgcsqaielclavlanpgqniliprpgfslyrtlaesmgiev
    klynllpeksweidlkqleslidektaclvvnnpsnpcgsvfskrhlqkilavaerqcvp
    iladeiygdmvfsdckyepmatlstnvpilscgglakrwlvpgwrlgwilihdrrdifgn
    eirdglvklsqrilgpctivqgalksilqrtpqefyqdtlsflksnadlcygalsaipgl
    qpvrpsgamylmvgiemehfpefendvefterliaeqsvhclpatcfeypnffrvvitvp
    evmmleacsriqefceqhy