PDB entry 3pdw

View 3pdw on RCSB PDB site
Description: Crystal structure of putative p-nitrophenyl phosphatase from Bacillus subtilis
Class: hydrolase
Keywords: structural genomics, PSI2, NYSGXRC, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, phosphatase fold, p-nitrophenyl phosphatase, HYDROLASE
Deposited on 2010-10-25, released 2010-11-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.185
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized hydrolase yutF
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yutF, BSU32290
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32125 (3-257)
      • expression tag (1-2)
      • expression tag (258-263)
    Domains in SCOPe 2.01: d3pdwa_
  • Heterogens: GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pdwA (A:)
    mslktykgylidldgtmyngtekieeacefvrtlkdrgvpylfvtnnssrtpkqvadklv
    sfdipateeqvfttsmataqhiaqqkkdasvyvigeegirqaieengltfggenadfvvv
    gidrsityekfavgclairngarfistngdiaiptergllpgngsltsvltvstgvqpvf
    igkpesiimeqamrvlgtdvsetlmvgdnyatdimaginagmdtllvhtgvtkrehmtdd
    mekpthaidsltewipyieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdwA (A:)
    slktykgylidldgtmyngtekieeacefvrtlkdrgvpylfvtnnssrtpkqvadklvs
    fdipateeqvfttsmataqhiaqqkkdasvyvigeegirqaieengltfggenadfvvvg
    idrsityekfavgclairngarfistngdiaiptergllpgngsltsvltvstgvqpvfi
    gkpesiimeqamrvlgtdvsetlmvgdnyatdimaginagmdtllvhtgmtddmekptha
    idsltewipyieghhhh