PDB entry 3pdu

View 3pdu on RCSB PDB site
Description: Crystal structure of gamma-hydroxybutyrate dehydrogenase from Geobacter sulfurreducens in complex with NADP+
Class: oxidoreductase
Keywords: gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde reductase, glyoxylate metabolism, Geobacter sulfurreducens, dehydrogenase/reductase, OXIDOREDUCTASE
Deposited on 2010-10-25, released 2012-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-01, with a file datestamp of 2016-05-27.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74DE4 (0-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d3pdua1, d3pdua2, d3pdua3
  • Chain 'B':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74DE4 (Start-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d3pdub1, d3pdub2, d3pdub3
  • Chain 'C':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74DE4 (Start-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d3pduc1, d3pduc2, d3pduc3
  • Chain 'D':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74DE4 (0-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d3pdud1, d3pdud2, d3pdud3
  • Chain 'E':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74DE4 (0-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d3pdue1, d3pdue2, d3pdue3
  • Chain 'F':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74DE4 (Start-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d3pduf1, d3pduf2, d3pduf3
  • Chain 'G':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pdug1, d3pdug2
  • Chain 'H':
    Compound: 3-hydroxyisobutyrate dehydrogenase family protein
    Species: Geobacter sulfurreducens [TaxId:35554]
    Gene: GSU1372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q74DE4 (Start-285)
      • expression tag (286)
    Domains in SCOPe 2.07: d3pduh1, d3pduh2, d3pduh3
  • Heterogens: NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pduA (A:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pduB (B:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pduB (B:)
    ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
    iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
    sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgqm
    mtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkdl
    rlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pduC (C:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pduC (C:)
    ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
    iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
    sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgqm
    mtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkdl
    rlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pduD (D:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pduE (E:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3pduF (F:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pduF (F:)
    ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
    iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
    sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgqm
    mtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkdl
    rlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3pduG (G:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pduG (G:)
    tygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacditi
    amladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapvs
    gtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgqmm
    talgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkdlr
    lavelgdrlgqplhgaatanesfkraraaghadedfaavfrvle
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3pduH (H:)
    mttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdi
    tiamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleap
    vsgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgq
    mmtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkd
    lrlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pduH (H:)
    ttygflglgimggpmaanlvragfdvtvwnrnpakcaplvalgarqasspaevcaacdit
    iamladpaaarevcfgangvlegigggrgyidmstvddetstaigaavtarggrfleapv
    sgtkkpaedgtliilaagdqslftdagpafaalgkkclhlgevgqgarmklvvnmimgqm
    mtalgegmalgrncgldggqllevldagamanpmfkgkgqmllsgefptsfplkhmqkdl
    rlavelgdrlgqplhgaatanesfkraraaghadedfaavfrvlea