PDB entry 3pdj

View 3pdj on RCSB PDB site
Description: Crystal Structure of Human 11-beta-Hydroxysteroid Dehydrogenase 1 (11b-HSD1) in Complex with 4,4-Disubstituted Cyclohexylbenzamide Inhibitor
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: 11beta, hydroxysteroid, dehydrogenase, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-10-22, released 2011-10-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-10-05, with a file datestamp of 2011-09-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11, HSD11B1, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (4-End)
      • expression tag (0-3)
      • engineered mutation (252)
    Domains in SCOPe 2.01: d3pdja_
  • Chain 'B':
    Compound: Corticosteroid 11-beta-dehydrogenase isozyme 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HSD11, HSD11B1, HSD11L
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28845 (4-272)
      • expression tag (1-3)
      • engineered mutation (252)
    Domains in SCOPe 2.01: d3pdjb_
  • Heterogens: 3PJ, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pdjA (A:)
    qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
    elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
    mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
    eysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyd
    sslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdjA (A:)
    qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
    elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
    mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
    eysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyd
    sslwttllirnpsrkileflystsynmdrfin
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pdjB (B:)
    qqplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcl
    elgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrks
    mevnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirk
    eysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyd
    sslwttllirnpsrkileflystsynmdrfink
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdjB (B:)
    qplneefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshcle
    lgaasahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksm
    evnflsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirke
    ysvsrvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyyds
    slwttllirnpsrkileflystsynmdrfink