PDB entry 3pdh

View 3pdh on RCSB PDB site
Description: Structure of Sir2Tm bound to a propionylated peptide
Class: hydrolase
Keywords: Rossmann fold, deacetylase, deacylase, depropionylase, N6-propionyl-lysine, HYDROLASE
Deposited on 2010-10-22, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.167
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: npdA, Sir2, TM_0490
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pdha_
  • Chain 'D':
    Compound: Cellular tumor antigen p53 18-residue peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pdhA (A:)
    mkmkefldllnesrltvtltgagistpsgipdfrgpngiykkysqnvfdidffyshpeef
    yrfakegifpmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnve
    eyycvrcekkytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssr
    aslmivlgsslvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvm
    eeggis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdhA (A:)
    mkmkefldllnesrltvtltgagistpsgipdfysqnvfdidffyshpeefyrfakegif
    pmlqakpnlahvllakleekglieavitqnidrlhqragskkvielhgnveeyycvrcek
    kytvedvikklessdvplcddcnslirpnivffgenlpqdalreaiglssraslmivlgs
    slvvypaaelplitvrsggklvivnlgetpfddiatlkynmdvvefarrvmeeggis
    

  • Chain 'D':
    No sequence available.