PDB entry 3pdf

View 3pdf on RCSB PDB site
Description: Discovery of Novel Cyanamide-Based Inhibitors of Cathepsin C
Class: hydrolase/hydrolase inhibitor
Keywords: Two domains, Cystein Protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-10-22, released 2011-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dipeptidyl peptidase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSC, CPPI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53634 (0-438)
      • conflict (205)
      • expression tag (439-440)
    Domains in SCOPe 2.08: d3pdfa1, d3pdfa2, d3pdfa3
  • Heterogens: LXV, NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pdfA (A:)
    dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
    tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvgt
    asenvyvntahlknsqekysnrlykydhnfvkainaiqkswtattymeyetltlgdmirr
    sgghsrkiprpkpapltaeiqqkilflptswdwrnvhginfvspvrnqascgscysfasm
    gmleaririltnnsqtpilspqevvscsqyaqgceggfpyliagkyaqdfglveeacfpy
    tgtdspckmkedcfryysseyhyvggfyggcnealmklelvhhgpmavafevyddflhyk
    kgiyhhtglrdpfnpfeltnhavllvgygtdsasgmdywivknswgtgwgengyfrirrg
    tdecaiesiavaatpipklen
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdfA (A:)
    dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
    tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkvfl
    ptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevvsc
    sqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvggf
    yggcnealmklelvhhgpmavafevyddflhykkgiyhhtdpfnpfeltnhavllvgygt
    dsasgmdywivknswgtgwgengyfrirrgtdecaiesiavaatpipklen