PDB entry 3pd4

View 3pd4 on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with glycyl-3'-aminoadenosine
Class: ligase
Keywords: alpha/beta fold, deacylase, editing, aminoacyl-tRNA synthetase, translation, LIGASE
Deposited on 2010-10-22, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.208
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: PAB1490, PYRAB13430, thrS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pd4a_
  • Chain 'B':
    Compound: threonyl-tRNA synthetase
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: PAB1490, PYRAB13430, thrS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pd4b_
  • Heterogens: A3G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pd4A (A:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpeearve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pd4A (A:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpeearv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pd4B (B:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpeearve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pd4B (B:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpee