PDB entry 3pd2

View 3pd2 on RCSB PDB site
Description: Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with seryl-3'-aminoadenosine
Class: ligase
Keywords: alpha/beta fold, deacylase, editing, aminoacyl-tRNA synthetase, translation, LIGASE
Deposited on 2010-10-22, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-05, with a file datestamp of 2014-02-28.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: PAB1490, PYRAB13430, thrS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pd2a_
  • Chain 'B':
    Compound: threonyl-tRNA synthetase
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: PAB1490, PYRAB13430, thrS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pd2b_
  • Heterogens: A3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pd2A (A:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpeearve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pd2B (B:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpeearve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pd2B (B:)
    mrvllihsdyieyevkdkalknpepisedmkrgrmeevlvafisvekvdeknpeevslka
    ieeiskvaeqvkaenvfvypfahlsselakpsvamdilnrvyqglkergfnvgkapfgyy
    kafkisckghplaelsrtivpee