PDB entry 3pcy

View 3pcy on RCSB PDB site
Description: the crystal structure of mercury-substituted poplar plastocyanin at 1.9-angstroms resolution
Deposited on 1985-12-10, released 1986-01-21
The last revision prior to the SCOP 1.55 freeze date was dated 1986-04-25, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.16
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d3pcy__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3pcy_ (-)
  idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
  dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn