PDB entry 3pcr

View 3pcr on RCSB PDB site
Description: Structure of EspG-Arf6 complex
Class: Protein transport
Keywords: BACTERIAL EFFECTOR, SMALL G PROTEIN, SMALL GTP-BINDING PROTEIN, ARF, ADP-RIBOSYLATION FACTOR 6, Protein transport
Deposited on 2010-10-21, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EspG
    Species: Escherichia coli [TaxId:83334]
    Gene: ECs4590, espG, Z5142
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ADP-ribosylation factor 6
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pcrb_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pcrB (B:)
    mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkirpl
    wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
    eiqeklgltrirdrnwyvqpscatsgdglyegltwltsnyks
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pcrB (B:)
    mrilmlgldaagkttilyklklgqsvttiptvgfnvetvtyknvkfnvwdvggqdkirpl
    wrhyytgtqglifvvdcadrdridearqelhriindremrdaiilifankqdlpdamkph
    eiqeklgltrirdrnwyvqpscatsgdglyegltwltsny