PDB entry 3pco

View 3pco on RCSB PDB site
Description: crystal structure of E. coli phenylalanine-tRNA synthetase complexed with phenylalanine and AMP
Class: ligase
Keywords: aminoacylation, tRNA-binding, DNA-binding domain, four-helix bundle, aminoacyl-tRNA synthetase, ATP-binding, ligase, nucleotide-binding, protein biosynthesis
Deposited on 2010-10-21, released 2011-03-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: 0.235
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phenylalanyl-tRNA synthetase, alpha subunit
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_1928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pcoa_
  • Chain 'B':
    Compound: Phenylalanyl-tRNA synthetase, beta chain
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Phenylalanyl-tRNA synthetase, alpha subunit
    Species: Escherichia coli [TaxId:562]
    Gene: EcDH1_1928
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3pcoc1, d3pcoc2
  • Chain 'D':
    Compound: Phenylalanyl-tRNA synthetase, beta chain
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PHE, AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pcoA (A:)
    mshlaelvasakaaisqasdvaaldnvrveylgkkghltlqmttlrelppeerpaagavi
    neakeqvqqalnarkaelesaalnarlaaetidvslpgrriengglhpvtrtidriesff
    gelgftvatgpeieddyhnfdalnipghhparadhdtfwfdttrllrtqtsgvqirtmka
    qqppiriiapgrvyrndydqthtpmfhqmeglivdtnisftnlkgtlhdflrnffeedlq
    irfrpsyfpftepsaevdvmgkngkwlevlgcgmvhpnvlrnvgidpevysgfafgmgme
    rltmlrygvtdlrsffendlrflkqfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pcoA (A:)
    rlaaetidvslpgrriengglhpvtrtidriesffgelgftvatgpeieddyhnfdalni
    pghhparadhdtfwfdttrllrtqtsgvqirtmkaqqppiriiapgrvyrndydqthtpm
    fhqmeglivdtnisftnlkgtlhdflrnffeedlqirfrpsyfpftepsaevdvmgkngk
    wlevlgcgmvhpnvlrnvgidpevysgfafgmgmerltmlrygvtdlrsffendlrflkq
    fk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pcoC (C:)
    mshlaelvasakaaisqasdvaaldnvrveylgkkghltlqmttlrelppeerpaagavi
    neakeqvqqalnarkaelesaalnarlaaetidvslpgrriengglhpvtrtidriesff
    gelgftvatgpeieddyhnfdalnipghhparadhdtfwfdttrllrtqtsgvqirtmka
    qqppiriiapgrvyrndydqthtpmfhqmeglivdtnisftnlkgtlhdflrnffeedlq
    irfrpsyfpftepsaevdvmgkngkwlevlgcgmvhpnvlrnvgidpevysgfafgmgme
    rltmlrygvtdlrsffendlrflkqfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pcoC (C:)
    aelvasakaaisqasdvaaldnvrveylgkkghltlqmttlrelppeerpaagavineak
    eqvqqalnarkaelesaalnarlaaetidvslpgrriengglhpvtrtidriesffgelg
    ftvatgpeieddyhnfdalnipghhparadhdtfwfdttrllrtqtsgvqirtmkaqqpp
    iriiapgrvyrndydqthtpmfhqmeglivdtnisftnlkgtlhdflrnffeedlqirfr
    psyfpftepsaevdvmgkngkwlevlgcgmvhpnvlrnvgidpevysgfafgmgmerltm
    lrygvtdlrsffendlrflkqfk
    

  • Chain 'D':
    No sequence available.