PDB entry 3pbg

View 3pbg on RCSB PDB site
Description: 6-phospho-beta-galactosidase form-c
Deposited on 1997-02-21, released 1997-07-23
The last revision prior to the SCOP 1.63 freeze date was dated 1997-07-23, with a file datestamp of 1997-07-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d3pbga_
  • Chain 'B':
    Domains in SCOP 1.63: d3pbgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pbgA (A:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
    vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
    wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pbgB (B:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
    vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
    wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie