PDB entry 3pbg

View 3pbg on RCSB PDB site
Description: 6-phospho-beta-galactosidase form-c
Class: hydrolase
Keywords: hydrolase, glycosyl hydrolase
Deposited on 1997-02-21, released 1997-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.174
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phospho-beta-d-galactosidase
    Species: Lactococcus lactis [TaxId:1358]
    Gene: LACG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pbga_
  • Chain 'B':
    Compound: 6-phospho-beta-d-galactosidase
    Species: Lactococcus lactis [TaxId:1358]
    Gene: LACG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3pbgb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pbgA (A:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
    vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
    wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pbgB (B:)
    mtktlpkdfifggataayqaegathtdgkgpvawdkylednywytaepasdfyhkypvdl
    elaeeygvngirisiawsrifptgygevnekgvefyhklfaechkrhvepfvtlhhfdtp
    ealhsngdflnreniehfidyaafcfeefpevnywttfneigpigdgqylvgkfppgiky
    dlakvfqshhnmmvsharavklykdkgykgeigvvhalptkypydpenpadvraaeledi
    ihnkfildatylghysdktmegvnhilaenggeldlrdedfqaldaakdlndflginyym
    sdwmqafdgeteiihngkgekgsskyqikgvgrrvapdyvprtdwdwiiypeglydqimr
    vkndypnykkiyitenglgykdefvdntvyddgridyvkqhlevlsdaiadganvkgyfi
    wslmdvfswsngyekryglfyvdfdtqerypkksahwykklaetqvie