PDB entry 3pbb

View 3pbb on RCSB PDB site
Description: Crystal structure of human secretory glutaminyl cyclase in complex with PBD150
Class: Transferase/Transferase inhibitor
Keywords: alpha/beta protein, alpha/beta-mixed fold, glutaminyl cyclase, secretory pathway, Transferase-Transferase inhibitor complex
Deposited on 2010-10-20, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.184
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pbba_
  • Chain 'B':
    Compound: Glutaminyl-peptide cyclotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: QPCT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pbbb_
  • Heterogens: PBD, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pbbA (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pbbA (A:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgeeaflhwspqdslygsrh
    laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel
    helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen
    ldestidnlnkilqvfvleylhl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pbbB (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
    lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
    aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
    ddneenldestidnlnkilqvfvleylhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pbbB (B:)
    asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
    qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
    vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgeeaflhwspqdslygsrh
    laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel
    helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen
    ldestidnlnkilqvfvleylhl