PDB entry 3pb1

View 3pb1 on RCSB PDB site
Description: Crystal Structure of a Michaelis Complex between Plasminogen Activator Inhibitor-1 and Urokinase-type Plasminogen Activator
Class: hydrolase Inhibitor/Hydrolase
Keywords: PAI-1, uPA, Michaelis complex, Structural Genomics, Structure 2 Function Project, S2F, hydrolase Inhibitor-Hydrolase complex
Deposited on 2010-10-20, released 2010-12-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Plasminogen activator, urokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU, RP11-417O11.1-002
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SWW8 (0-End)
      • conflict (120)
      • conflict (143)
      • engineered mutation (197)
    Domains in SCOPe 2.06: d3pb1e_
  • Chain 'I':
    Compound: Plasminogen activator inhibitor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINE1, PAI1, PLANH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (Start-378)
      • engineered mutation (149)
      • engineered mutation (153)
      • conflict (157)
      • engineered mutation (318)
      • engineered mutation (353)
    Domains in SCOPe 2.06: d3pb1i_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3pb1E (E:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdaggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtkeenglal
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pb1E (E:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdaggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtke
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3pb1I (I:)
    vhhppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqa
    amgfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrst
    vkqvdfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfp
    dssthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaap
    yekevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfr
    qfqadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflf
    vvrhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pb1I (I:)
    psyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaamgf
    kiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvkqv
    dfseverarfiindwvkthtkgmishllgtgavqqltrlvlvnalyfngqwktpfpdsst
    hrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapyeke
    vplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrqfqa
    dftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvvrh
    nptgtvlfmgqvmep