PDB entry 3par

View 3par on RCSB PDB site
Description: Surfactant Protein-A neck and carbohydrate recognition domain (NCRD) in the absence of ligand
Class: sugar binding protein
Keywords: collectin, carbohydrate binding, lectin, mannose, SUGAR BINDING PROTEIN
Deposited on 2010-10-19, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sftp-1, Sftp1, Sftpa, Sftpa1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08427 (Start-147)
      • engineered mutation (106)
    Domains in SCOPe 2.08: d3para1, d3para2
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3parA (A:)
ayldeelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctragg
niavprtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqg
kekcvemytdgtwndrgclqyrlavcef

    Sequence, based on observed residues (ATOM records): (download) 
    >3parA (A:)
eelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctraggniav
prtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqgkekc
vemytdgtwndrgclqyrlavcef