PDB entry 3paa

View 3paa on RCSB PDB site
Description: Mechanism of inactivation of E. coli aspartate aminotransferase by (S)-4-amino-4,5-dihydro-2-furancarboxylic acid (S-ADFA) pH 8.0
Class: transferase
Keywords: pmp, sadfa, transferase
Deposited on 2010-10-19, released 2010-12-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: aspC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3paaa_
  • Heterogens: PJ7, PMP, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3paaA (A:)
    mfenitaapadpilgladlfraderpgkinlgigvykdetgktpvltsvkkaeqyllene
    ttknylgidgipefgrctqellfgkgsalindkrartaqtpggtgalrvaadflakntsv
    krvwvsnpswpnhksvfnsaglevreyayydaenhtldfdalinslneaqagdvvlfhgc
    chnptgidptleqwqtlaqlsvekgwlplfdfayqgfargleedaeglrafaamhkeliv
    assysknfglynervgactlvaadsetvdrafsqmkaairanysnppahgasvvatilsn
    dalraiweqeltdmrqriqrmrqlfvntlqekganrdfsfiikqngmfsfsgltkeqvlr
    lreefgvyavasgrvnvagmtpdnmaplceaivavl