PDB entry 3pa4

View 3pa4 on RCSB PDB site
Description: X-ray crystal structure of compound 2a bound to human CHK1 kinase domain
Class: transferase/transferase inhibitor
Keywords: kinase, phosphatase, transferase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-10-18, released 2010-12-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.225
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pa4a_
  • Heterogens: C72, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pa4A (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pa4A (A:)
    vedwdlvqtlgegaygevqlavnrvteeavavkivdmnikkeicinkmlnhenvvkfygh
    rregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikp
    enlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvws
    cgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsar
    itipdikkdrwynkplkkg