PDB entry 3p9x

View 3p9x on RCSB PDB site
Description: Crystal structure of phosphoribosylglycinamide formyltransferase from Bacillus Halodurans
Class: transferase
Keywords: Phosphoribosylglycinamide formyltransferase,PURINE BIOSYNTHESIS, TRANSFERASE, Structural Genomics, PSI-biology, Protein Structure Initiative, New York Structural Genomics Research Consortium, NYSGRC
Deposited on 2010-10-18, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: PURN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KF54 (Start-188)
      • expression tag (189-196)
    Domains in SCOPe 2.07: d3p9xa1, d3p9xa2
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: PURN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KF54 (Start-188)
      • expression tag (189-195)
    Domains in SCOPe 2.07: d3p9xb1, d3p9xb2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p9xA (A:)
    vmkrvaifasgsgtnaeaiiqsqkagqlpcevallitdkpgakvvervkvheipvcaldp
    ktypskeayeievvqqlkekqidfvvlagymrlvgptllgayegrivnihpsllpafpgl
    haieqairanvkvtgvtihyvdegmdtgpiiaqeavsieeedtletlttkiqavehrlyp
    atlhkllskaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9xA (A:)
    krvaifasgsgtnaeaiiqsqkagqlpcevallitdkpgakvvervkvheipvcaldpkt
    ypskeayeievvqqlkekqidfvvlagymrlvgptllgayegrivnihpsllpafpglha
    ieqairanvkvtgvtihyvdegmdtgpiiaqeavsieeedtletlttkiqavehrlypat
    lhkllskaenlyfqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p9xB (B:)
    vmkrvaifasgsgtnaeaiiqsqkagqlpcevallitdkpgakvvervkvheipvcaldp
    ktypskeayeievvqqlkekqidfvvlagymrlvgptllgayegrivnihpsllpafpgl
    haieqairanvkvtgvtihyvdegmdtgpiiaqeavsieeedtletlttkiqavehrlyp
    atlhkllskaenlyfqshhhhhhwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9xB (B:)
    krvaifasgsgtnaeaiiqsqkagqlpcevallitdkpgakvvervkvheipvcaldpkt
    ypskeayeievvqqlkekqidfvvlagymrlvgptllgayegrivnihpsllpafpglha
    ieqairanvkvtgvtihyvdegmdtgpiiaqeavsieeedtletlttkiqavehrlypat
    lhkllskaenlyfq