PDB entry 3p9s

View 3p9s on RCSB PDB site
Description: Structure of I274A variant of E. coli KatE
Class: oxidoreductase
Keywords: catalase, I274A variant, heme orientation, OXIDOREDUCTASE
Deposited on 2010-10-18, released 2010-12-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.14
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (273)
    Domains in SCOPe 2.04: d3p9sa1, d3p9sa2
  • Chain 'B':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (273)
    Domains in SCOPe 2.04: d3p9sb1, d3p9sb2
  • Chain 'C':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (273)
    Domains in SCOPe 2.04: d3p9sc1, d3p9sc2
  • Chain 'D':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:83333]
    Gene: b1732, JW1721, katE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered mutation (273)
    Domains in SCOPe 2.04: d3p9sd1, d3p9sd2
  • Heterogens: HDD, HDE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p9sA (A:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgahtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9sA (A:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgahtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p9sB (B:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgahtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9sB (B:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgahtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p9sC (C:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgahtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9sC (C:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgahtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p9sD (D:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivhargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgahtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9sD (D:)
    slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
    iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
    tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
    iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
    tmegfgahtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
    agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
    qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
    mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
    prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
    ddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkakg
    vhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylme
    aykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsripk
    idkipa