PDB entry 3p9h

View 3p9h on RCSB PDB site
Description: Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
Class: protein transport
Keywords: PROTEIN TRANSPORT, Ubiquitin
Deposited on 2010-10-17, released 2011-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99816 (5-144)
      • expression tag (4)
      • see remark 999 (47)
    Domains in SCOPe 2.06: d3p9ha1, d3p9ha2
  • Chain 'B':
    Compound: gag polyprotein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3p9hA (A:)
gamgsavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyggsrelmnltgtip
vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
qsdllgliqvmivvfgdeppvfsrp

    Sequence, based on observed residues (ATOM records): (download) 
    >3p9hA (A:)
savsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyggsrelmnltgtipvpyr
gntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdl
lgliqvmivvfgdeppvfsrp

  • Chain 'B':
    No sequence available.