PDB entry 3p95

View 3p95 on RCSB PDB site
Description: Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (BPTI-K15R/R17D)
Class: hydrolase/hydrolase inhibitor
Keywords: Human mesotrypsin-canonical inhibitor complex, Mesotrypsin, Trypsin IV, Bovine Pancreatic Trypsin Inhibitor, canonical inhibitor, BPTI-K15R/R17D, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-10-15, released 2011-08-31
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.111
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: PRSS3 protein
  Species: Homo sapiens [TaxId:9606]
  Gene: PRSS3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8N2U3 (0-223)
    • engineered mutation (176)
  Domains in SCOPe 2.01: d3p95a_
• Chain 'E':
  Compound: pancreatic trypsin inhibitor
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00974 (0-57)
    • engineered mutation (14)
    • engineered mutation (16)
  Domains in SCOPe 2.01: d3p95e_
• Heterogens: CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p95A (A:)
  ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
  neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
  wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
  vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p95E (E:)
  rpdfcleppytgpcradiiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga