SCOPe 2.08: Structural Classification of Proteins

PDB entry 3p93

View 3p93 on RCSB PDB site
Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
Class: isomerase
Keywords: Enolase fold, multifunctional enzyme, Enolase superfamily, D-Mannonate, D-Gluconate, ISOMERASE
Deposited on 2010-10-15, released 2011-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93a1, d3p93a2, d3p93a3
Chain 'B':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93b1, d3p93b2, d3p93b3
Chain 'C':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93c1, d3p93c2, d3p93c3
Chain 'D':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93d1, d3p93d2, d3p93d3
Chain 'E':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93e1, d3p93e2, d3p93e3
Chain 'F':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93f1, d3p93f2, d3p93f3
Chain 'G':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93g1, d3p93g2, d3p93g3
Chain 'H':
Compound: Mandelate racemase/muconate lactonizing enzyme
Species: Chromohalobacter salexigens [TaxId:158080]
Gene: Csal_2974
Database cross-references and differences (RAF-indexed):
- Uniprot Q1QT89 (3-404)
  - expression tag (2)
Domains in SCOPe 2.08: d3p93h1, d3p93h2, d3p93h3
Heterogens: MG, CS2, KDG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3p93A (A:)
mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
edghflagespghgvdideelaakypyeraslpvnrledgtlwhw