PDB entry 3p92
View 3p92 on RCSB PDB site
Description: Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (BPTI-K15R/R17G)
Class: hydrolase/hydrolase inhibitor
Keywords: mesotrypsin, trypsin IV, canonical inhibitor, bovine pancreatic trypsin inibitor, BPTI, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on
2010-10-15, released
2011-08-31
The last revision prior to the SCOPe 2.02 freeze date was dated
2011-11-09, with a file datestamp of
2011-11-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.115
AEROSPACI score: 0.66
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: PRSS3 protein
Species: Homo sapiens [TaxId:9606]
Gene: PRSS3
Database cross-references and differences (RAF-indexed):
- Uniprot Q8N2U3 (0-223)
- engineered mutation (176)
Domains in SCOPe 2.02: d3p92a_ - Chain 'E':
Compound: pancreatic trypsin inhibitor
Species: Bos taurus [TaxId:9913]
Database cross-references and differences (RAF-indexed):
- Uniprot P00974 (0-57)
- engineered mutation (14)
- engineered mutation (16)
Domains in SCOPe 2.02: d3p92e_ - Heterogens: CA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3p92A (A:)
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3p92E (E:)
rpdfcleppytgpcragiiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga