PDB entry 3p90

View 3p90 on RCSB PDB site
Description: Crystal Structure Analysis of H207F Mutant of Human CLIC1
Class: transport protein
Keywords: CLIC; Glutathione Transferase, thioredoxin, pH sensor, ion channel, TRANSPORT PROTEIN
Deposited on 2010-10-15, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, G6, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (Start-240)
      • engineered mutation (206)
    Domains in SCOPe 2.08: d3p90a1, d3p90a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p90A (A:)
    maeeqpqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcp
    ggqlpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayikn
    snpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnl
    lpklhivqvvckkyrgftipeafrgvfrylsnayareefastcpddeeielayeqvakal
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p90A (A:)
    pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlp
    fllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpal
    ndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpklh
    ivqvvckkyrgftipeafrgvfrylsnayareefastcpddeeielayeqvakalk