PDB entry 3p8x

View 3p8x on RCSB PDB site
Description: Synthesis, Structure, and Biological Activity of des-Side Chain Analogues of 1alpha,25-Dihydroxyvitamin D3 with Substituents at C-18
Class: Transcription Regulator
Keywords: helices sandwich, transcription regulation, vitamin D, Transcription Regulator
Deposited on 2010-10-15, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vitamin D3 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: Vdr, Nr1i1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11473 (21-67)
    • Uniprot P11473 (69-End)
      • expression tag (68)
    Domains in SCOPe 2.07: d3p8xa_
  • Heterogens: ZYD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p8xA (A:)
    mgsshhhhhhssglvprgshmdslrpklseeqqriiailldahhktydptysdfcqfrpp
    vrvndgggsvtlelsqlsmlphladlvsysiqkvigfakmipgfrdltsedqivllkssa
    ievimlrsnesftmddmswtcgnqdykyrvsdvtkaghslelieplikfqvglkklnlhe
    eehvllmaicivspdrpgvqdaalieaiqdrlsntlqtyircrhpppgshllyakmiqkl
    adlrslneehskqyrclsfqpecsmkltplvlevfgneis
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8xA (A:)
    dslrpklseeqqriiailldahhktydptysdfcqfrppvrvndgggsvtlelsqlsmlp
    hladlvsysiqkvigfakmipgfrdltsedqivllkssaievimlrsnesftmddmswtc
    gnqdykyrvsdvtkaghslelieplikfqvglkklnlheeehvllmaicivspdrpgvqd
    aalieaiqdrlsntlqtyircrhpppgshllyakmiqkladlrslneehskqyrclsfqp
    ecsmkltplvlevfg