PDB entry 3p8u

View 3p8u on RCSB PDB site
Description: Crystal structure of mEosFP in its green state
Class: fluorescent protein
Keywords: Beta-barrel, Fluorescent protein
Deposited on 2010-10-15, released 2011-10-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.234
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (128)
      • engineered mutation (163)
    Domains in SCOPe 2.03: d3p8ua_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • chromophore (69)
      • engineered mutation (128)
      • engineered mutation (163)
    Domains in SCOPe 2.03: d3p8ub_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • expression tag (4-5)
      • chromophore (69)
      • engineered mutation (128)
      • engineered mutation (163)
    Domains in SCOPe 2.03: d3p8uc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (6-End)
      • chromophore (69)
      • engineered mutation (128)
      • engineered mutation (163)
    Domains in SCOPe 2.03: d3p8ud_
  • Heterogens: SO3, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p8uA (A:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfr
    ttykakekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8uA (A:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p8uB (B:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfr
    ttykakekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8uB (B:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
    gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
    kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p8uC (C:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfr
    ttykakekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8uC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttyk
    akekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p8uD (D:)
    hhhhhhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfaf
    dilttafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtf
    ynkvrfhgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfr
    ttykakekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8uD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
    ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn