PDB entry 3p8p

View 3p8p on RCSB PDB site
Description: Crystal Structure of Human Dimethylarginine Dimethylaminohydrolase-1 (DDAH-1) variant C274S bound with N5-(1-iminopentyl)-L-ornithine
Class: hydrolase/hydrolase inhibitor
Keywords: DDAH, NITRIC OXIDE SYNTHASE REGULATOR, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2010-10-14, released 2010-11-10
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDAH, DDAH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94760
      • engineered mutation (296)
    Domains in SCOPe 2.04: d3p8pa_
  • Chain 'B':
    Compound: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDAH, DDAH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94760
      • engineered mutation (296)
    Domains in SCOPe 2.04: d3p8pb_
  • Heterogens: LN6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p8pA (A:)
    mgsshhhhhhssglvprgshmasmaglghpaafgrathavvralpeslgqhalrsakgee
    vdvaraerqhqlyvgvlgsklglqvvelpadeslpdcvfvedvavvceetalitrpgaps
    rrkevdmmkealeklqlnivemkdenatldggdvlftgreffvglskrtnqrgaeiladt
    fkdyavstvpvadglhlksfcsmagpnliaigssesaqkalkimqqmsdhrydkltvpdd
    iaanciylnipnkghvllhrtpeeypesakvyeklkdhmlipvsmselekvdglltscsv
    linkkvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8pA (A:)
    aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
    deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
    ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
    igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
    vyeklkdhmlipvsmselekvdglltscsvlinkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p8pB (B:)
    mgsshhhhhhssglvprgshmasmaglghpaafgrathavvralpeslgqhalrsakgee
    vdvaraerqhqlyvgvlgsklglqvvelpadeslpdcvfvedvavvceetalitrpgaps
    rrkevdmmkealeklqlnivemkdenatldggdvlftgreffvglskrtnqrgaeiladt
    fkdyavstvpvadglhlksfcsmagpnliaigssesaqkalkimqqmsdhrydkltvpdd
    iaanciylnipnkghvllhrtpeeypesakvyeklkdhmlipvsmselekvdglltscsv
    linkkvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8pB (B:)
    aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
    deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
    ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
    igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
    vyeklkdhmlipvsmselekvdglltscsvlinkk