PDB entry 3p8m

View 3p8m on RCSB PDB site
Description: Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized by leucine zipper
Class: protein binding
Keywords: Phage display, Leucine zipper, Hub protein, Protein binding
Deposited on 2010-10-14, released 2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynein light chain 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DYNLL2, DLC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p8ma_
  • Chain 'B':
    Compound: dynein light chain 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DYNLL2, DLC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p8mb_
  • Chain 'C':
    Compound: General control protein GCN4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GCN4, AAS3, ARG9, YEL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (14-End)
      • expression tag (1)
      • see remark 999 (2-9)
      • linker (10-13)
  • Chain 'D':
    Compound: General control protein GCN4
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GCN4, AAS3, ARG9, YEL009C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03069 (14-End)
      • expression tag (0-1)
      • see remark 999 (2-9)
      • linker (10-13)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p8mA (A:)
    gshmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhci
    vgrnfgsyvthetkhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8mA (A:)
    drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf
    gsyvthetkhfiyfylgqvaillfksg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p8mB (B:)
    gshmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhci
    vgrnfgsyvthetkhfiyfylgqvaillfksg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8mB (B:)
    drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf
    gsyvthetkhfiyfylgqvaillfksg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.