PDB entry 3p8m
View 3p8m on RCSB PDB site
Description: Human dynein light chain (DYNLL2) in complex with an in vitro evolved peptide dimerized by leucine zipper
Class: protein binding
Keywords: Phage display, Leucine zipper, Hub protein, Protein binding
Deposited on
2010-10-14, released
2011-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated
2011-08-31, with a file datestamp of
2011-08-26.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.25
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: dynein light chain 2
Species: Homo sapiens [TaxId:9606]
Gene: DYNLL2, DLC2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3p8ma_ - Chain 'B':
Compound: dynein light chain 2
Species: Homo sapiens [TaxId:9606]
Gene: DYNLL2, DLC2
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d3p8mb_ - Chain 'C':
Compound: General control protein GCN4
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: GCN4, AAS3, ARG9, YEL009C
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (14-End)
- expression tag (1)
- see remark 999 (2-9)
- linker (10-13)
- Chain 'D':
Compound: General control protein GCN4
Species: Saccharomyces cerevisiae [TaxId:4932]
Gene: GCN4, AAS3, ARG9, YEL009C
Database cross-references and differences (RAF-indexed):
- Uniprot P03069 (14-End)
- expression tag (0-1)
- see remark 999 (2-9)
- linker (10-13)
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3p8mA (A:)
gshmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhci
vgrnfgsyvthetkhfiyfylgqvaillfksg
Sequence, based on observed residues (ATOM records): (download)
>3p8mA (A:)
drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetkhfiyfylgqvaillfksg
- Chain 'B':
Sequence, based on SEQRES records: (download)
>3p8mB (B:)
gshmsdrkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhci
vgrnfgsyvthetkhfiyfylgqvaillfksg
Sequence, based on observed residues (ATOM records): (download)
>3p8mB (B:)
drkaviknadmsedmqqdavdcatqamekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetkhfiyfylgqvaillfksg
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.