PDB entry 3p8b

View 3p8b on RCSB PDB site
Description: X-ray crystal structure of Pyrococcus furiosus transcription elongation factor Spt4/5
Class: transferase/transcription
Keywords: transcription elongation factor, RNA polymerase, TRANSFERASE-TRANSCRIPTION complex
Deposited on 2010-10-13, released 2011-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-05-11, with a file datestamp of 2011-05-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.239
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase, subunit e''
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF0255, Spt4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p8ba_
  • Chain 'B':
    Compound: Transcription antitermination protein nusG
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1990, Spt5
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerase, subunit e''
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF0255, Spt4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p8bc_
  • Chain 'D':
    Compound: Transcription antitermination protein nusG
    Species: Pyrococcus furiosus [TaxId:2261]
    Gene: PF1990, Spt5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p8bA (A:)
    mgsshhhhhhssglvprgshmsekacrhchyitsedrcpvcgsrdlseewfdlviivdve
    nseiakkigakvpgkyairvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8bA (A:)
    sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p8bC (C:)
    mgsshhhhhhssglvprgshmsekacrhchyitsedrcpvcgsrdlseewfdlviivdve
    nseiakkigakvpgkyairvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8bC (C:)
    sekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
    

  • Chain 'D':
    No sequence available.