PDB entry 3p88

View 3p88 on RCSB PDB site
Description: FXR bound to isoquinolinecarboxylic acid
Class: transcription/inhibitor
Keywords: nuclear recptor FXR, TRANSCRIPTION-INHIBITOR complex
Deposited on 2010-10-13, released 2011-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Farnesoid X receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: hCG_20893, NR1H4
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6ZGS9 (0-228)
      • conflict (41)
      • engineered mutation (188)
      • engineered mutation (222)
    Domains in SCOPe 2.08: d3p88a_
  • Chain 'B':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BHLHE74, NCOA1, SRC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: P88, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p88A (A:)
    eltpdqqtllhfimdsynkqrmpqeitnkilkeefsaeenfeiltematnhvqvlveftk
    klpgfqtldhedqiallkgsaveamflrsaeifnkklpsghsdlleerirnsgisdeyit
    pmfsfyksigelkmtqeeyalltaivilspdrqyikdreaveklqeplldvlqklckihq
    penpqhfaellgrltelrtfnhhhaemlmswrvndhkftplleeiwdvq
    

  • Chain 'B':
    No sequence available.