PDB entry 3p75

View 3p75 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V104D at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hyperstable variant, pdtp, hydrolase
Deposited on 2010-10-12, released 2010-11-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-128)
      • engineered mutation (37-38)
      • engineered mutation (91)
      • engineered mutation (104)
      • engineered mutation (111)
      • engineered mutation (115)
    Domains in SCOPe 2.03: d3p75a_
  • Heterogens: CA, THP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3p75A (A:)
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealdrqglakvayvykgnntheqllrkaeaqa
kkeklniws