PDB entry 3p74

View 3p74 on RCSB PDB site
Description: H181N mutant of pentaerythritol tetranitrate reductase containing a C-terminal His8-tag
Class: oxidoreductase
Keywords: old yellow enzyme family, alpha/beta barrel, OXIDOREDUCTASE
Deposited on 2010-10-12, released 2011-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.137
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr, PETNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71278 (Start-364)
      • engineered mutation (181)
      • expression tag (365-366)
    Domains in SCOPe 2.06: d3p74a1, d3p74a2
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p74A (A:)
    msaeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseat
    qisaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqap
    vsasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlve
    lnsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigt
    fqnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviig
    agaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegyt
    dypslhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p74A (A:)
    klftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqisa
    qakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsas
    alnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelnsa
    hgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqnv
    dngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigagay
    taekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyps
    lhh