PDB entry 3p72

View 3p72 on RCSB PDB site
Description: structure of platelet Glycoprotein 1b alpha with a bound peptide inhibitor
Class: Blood Clotting/Inhibitor
Keywords: Leucine-rich repeat, Coagulation, Inhibitor, Blood Clotting-Inhibitor complex
Deposited on 2010-10-12, released 2010-11-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet glycoprotein ib alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: GP1BA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07359 (0-264)
      • engineered mutation (20)
      • engineered mutation (158)
      • expression tag (265-268)
    Domains in SCOPe 2.08: d3p72a1, d3p72a2
  • Chain 'B':
    Compound: OS1 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3P72 (0-10)
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3p72A (A:)
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcplvpr

  • Chain 'B':
    No sequence available.