PDB entry 3p6y

View 3p6y on RCSB PDB site
Description: CF Im25-CF Im68-UGUAA complex
Class: RNA binding protein/RNA
Keywords: RRM domain, RNA binding, nuclear, RNA BINDING PROTEIN-RNA complex
Deposited on 2010-10-11, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194)
  • Chain 'B':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-196)
  • Chain 'C':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p6yc_
  • Chain 'D':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p6yd_
  • Chain 'E':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194)
  • Chain 'F':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-196)
  • Chain 'G':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p6yg_
  • Chain 'H':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p6yh_
  • Chain 'I':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194)
  • Chain 'J':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-196)
  • Chain 'K':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p6yk_
  • Chain 'L':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p6yl_
  • Chain 'M':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-195)
  • Chain 'N':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-196)
  • Chain 'O':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p6yo_
  • Chain 'P':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p6yp_
  • Chain 'Q':
    Compound: 5'-r(*up*gp*up*ap*a)-3'
  • Chain 'R':
    Compound: 5'-r(*up*gp*up*ap*a)-3'
  • Chain 'S':
    Compound: 5'-r(*up*gp*up*ap*a)-3'
  • Chain 'T':
    Compound: 5'-r(*up*gp*up*ap*a)-3'
  • Chain 'U':
    Compound: 5'-r(*up*gp*up*ap*a)-3'
  • Chain 'V':
    Compound: 5'-r(*up*gp*up*ap*a)-3'
  • Chain 'W':
    Compound: 5'-r(*up*gp*up*ap*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >3p6yC (C:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yC (C:)
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtps

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >3p6yD (D:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yD (D:)
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvseasskklm
dllpkrelhgqnpvvtps

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download) 
    >3p6yG (G:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yG (G:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtps

  • Chain 'H':
    Sequence, based on SEQRES records: (download) 
    >3p6yH (H:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yH (H:)
lyignltwwttdedlteavhslvndileikffenrangqskgfalvgvseasskklmdll
pkrelhgqnpvvtp

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download) 
    >3p6yK (K:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yK (K:)
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtpsn

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3p6yL (L:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yL (L:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtps

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download) 
    >3p6yO (O:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yO (O:)
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtpsn

  • Chain 'P':
    Sequence, based on SEQRES records: (download) 
    >3p6yP (P:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p6yP (P:)
yignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskklmdl
lpkrelhgqnpvvtp

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.