PDB entry 3p6f

View 3p6f on RCSB PDB site
Description: Human adipocyte lipid-binding protein FABP4 in complex with (S)-3-phenyl butyric acid
Class: lipid binding protein
Keywords: lipocalin, beta barrel, fatty acid binding protein, LIPID BINDING PROTEIN
Deposited on 2010-10-11, released 2011-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.157
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid-binding protein, adipocyte
  Species: Homo sapiens [TaxId:9606]
  Gene: FABP4
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15090 (7-138)
    • expression tag (0-6)
  Domains in SCOPe 2.08: d3p6fa1, d3p6fa2
• Heterogens: FBZ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p6fA (A:)
  qqmgrgsmcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitik
  sestfknteisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddk
  lvvecvmkgvtstrvyera