PDB entry 3p63

View 3p63 on RCSB PDB site
Description: Structure of M. laminosus Ferredoxin with a shorter L1,2 loop
Class: electron transport
Keywords: ferredoxin, thermostability, beta-grasp fold, redox, Fe2S2, concerting the L1,2 loop into a beta-turn, ELECTRON TRANSPORT
Deposited on 2010-10-11, released 2011-02-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-09, with a file datestamp of 2013-10-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin
    Species: Mastigocladus laminosus [TaxId:83541]
    Gene: petF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00248 (0-End)
      • see remark 999 (9-11)
    Domains in SCOPe 2.04: d3p63a_
  • Chain 'B':
    Compound: ferredoxin
    Species: Mastigocladus laminosus [TaxId:83541]
    Gene: petF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00248 (0-End)
      • see remark 999 (9-11)
    Domains in SCOPe 2.04: d3p63b_
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p63A (A:)
    atykvtlinptgnktievpddqyildaaeeagidlpyscragacstcagklisgtvdqsd
    qsfldddqieagyvltcvayptsdcviethkeeely
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p63A (A:)
    atykvtlinptgnktievpddqyildaaeeagidlpyscragacstcagklisgtvdqsd
    qsfldddqieagyvltcvayptsdcviethkeeel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p63B (B:)
    atykvtlinptgnktievpddqyildaaeeagidlpyscragacstcagklisgtvdqsd
    qsfldddqieagyvltcvayptsdcviethkeeely
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p63B (B:)
    atykvtlinptgnktievpddqyildaaeeagidlpyscragacstcagklisgtvdqsd
    qsfldddqieagyvltcvayptsdcviethkeeel