PDB entry 3p61

View 3p61 on RCSB PDB site
Description: Crystal structure of the mutant R160A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor BMP
Class: lyase
Keywords: tim barrel, orotidine 5'-monophosphate decarboxylase, inhibitor BMP, LYASE
Deposited on 2010-10-11, released 2011-09-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.2
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Methanobacterium thermoautotrophicum [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
      • engineered mutation (159)
  • Chain 'B':
    Compound: orotidine 5'-monophosphate decarboxylase
    Species: Methanobacterium thermoautotrophicum [TaxId:187420]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • conflict (100)
      • engineered mutation (159)
    Domains in SCOPe 2.02: d3p61b_
  • Heterogens: BMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p61B (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstaperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p61B (B:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstaperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesikdll