PDB entry 3p5m

View 3p5m on RCSB PDB site
Description: Crystal structure of an enoyl-CoA hydratase/isomerase from Mycobacterium avium
Class: isomerase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, Coenzyme A, mycobacterium, tuberculosis, non-pathogenic species, ortholog, ISOMERASE
Deposited on 2010-10-08, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2601
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QFV4 (4-254)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3p5ma1, d3p5ma2
  • Chain 'B':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2601
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QFV4 (4-254)
      • expression tag (3)
    Domains in SCOPe 2.07: d3p5mb1, d3p5mb2
  • Chain 'C':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2601
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QFV4 (4-254)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3p5mc1, d3p5mc2
  • Chain 'D':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2601
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QFV4 (4-254)
      • expression tag (3)
    Domains in SCOPe 2.07: d3p5md1, d3p5md2
  • Chain 'E':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2601
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p5me_
  • Chain 'F':
    Compound: enoyl-CoA hydratase/isomerase
    Species: Mycobacterium avium [TaxId:243243]
    Gene: MAV_2601
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QFV4 (4-254)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3p5mf1, d3p5mf2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p5mA (A:)
    gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
    rafcsggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaa
    pasyfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsa
    deyesvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfreg
    arafrerrtpnfrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5mA (A:)
    gsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagra
    fcsggdldtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyf
    qlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyes
    vltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafr
    errtpnfrgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p5mB (B:)
    gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
    rafcsggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaa
    pasyfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsa
    deyesvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfreg
    arafrerrtpnfrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5mB (B:)
    smngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagraf
    csggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapas
    yfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadey
    esvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregara
    frerrtpnfrgh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p5mC (C:)
    gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
    rafcsggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaa
    pasyfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsa
    deyesvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfreg
    arafrerrtpnfrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5mC (C:)
    gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
    rafcsggddtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasy
    fqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeye
    svltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregaraf
    rerrtpnfrgh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p5mD (D:)
    gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
    rafcsggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaa
    pasyfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsa
    deyesvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfreg
    arafrerrtpnfrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5mD (D:)
    smngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagraf
    csggddtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyfql
    aftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyesvl
    tdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafrer
    rtpnfrgh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p5mE (E:)
    gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
    rafcsggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaa
    pasyfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsa
    deyesvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfreg
    arafrerrtpnfrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5mE (E:)
    mngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagrafc
    sggggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyfql
    aftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyesvl
    tdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafrer
    rtpnfrgh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3p5mF (F:)
    gpgsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgag
    rafcsggdltggdtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaa
    pasyfqlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsa
    deyesvltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfreg
    arafrerrtpnfrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5mF (F:)
    gsmngisvehdgavlrirldrpeklnavdtpmleelsvhirdaeadesvravlltgagra
    fcsggdldtagaadaanrvvraitslpkpviagvhgaavgfgcslalacdlvvaapasyf
    qlaftrvglmpdggasallplligrartsrmamtaekisaatafewgmishitsadeyes
    vltdvlrsvsggptlafgwtkralaaatlaelepvqaieaegqlalvetadfregarafr
    errtpnfrgh