PDB entry 3p5g

View 3p5g on RCSB PDB site
Description: Structure of the carbohydrate-recognition domain of human Langerin with Blood group B trisaccharide (Gal alpha1-3(Fuc alpha1-2)Gal)
Class: sugar binding protein
Keywords: C-type lectin, carbohydrate-binding, SUGAR BINDING PROTEIN
Deposited on 2010-10-08, released 2010-12-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p5ga_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p5gb_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p5gc_
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3p5gd_
  • Heterogens: CA, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p5gA (A:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5gA (A:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p5gB (B:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5gB (B:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p5gC (C:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5gC (C:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktfl
    fickrpyvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p5gD (D:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5gD (D:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktfl
    fickrpyvp