PDB entry 3p4o
View 3p4o on RCSB PDB site
Description: Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
Class: Immune System
Keywords: H2-Kb, LCMV-V3A, LCMV, TCR, T cell, MHC, viral escape, Immune System
Deposited on
2010-10-06, released
2011-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated
2011-10-12, with a file datestamp of
2011-10-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3p4ob_ - Chain 'C':
Compound: NP205-LCMV epitope, YTAKYPNL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3p4oe_ - Chain 'F':
Compound: NP205-LCMV epitope, YTAKYPNL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: ACE, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3p4oB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3p4oE (E:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'F':
No sequence available.