PDB entry 3p4o

View 3p4o on RCSB PDB site
Description: Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
Class: Immune System
Keywords: H2-Kb, LCMV-V3A, LCMV, TCR, T cell, MHC, viral escape, Immune System
Deposited on 2010-10-06, released 2011-10-12
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-10-12, with a file datestamp of 2011-10-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01901 (1-277)
      • expression tag (0)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3p4ob_
  • Chain 'C':
    Compound: NP205-LCMV epitope, YTAKYPNL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91B91 (0-7)
      • engineered mutation (2)
  • Chain 'D':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3p4oe_
  • Chain 'F':
    Compound: NP205-LCMV epitope, YTAKYPNL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91B91 (0-7)
      • engineered mutation (2)
  • Heterogens: ACE, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4oB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4oE (E:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'F':
    No sequence available.